Skip to main content

Advertisement

Table 3 Peptides sequencing and identification results

From: Variability of serum novel serum peptide biomarkers correlates with the disease states of multiple myeloma

Molecular weight (Da) Peptide name International Protein Index Amino acid sequence
2660.65 α-Fibrinogen IPI00021885 DEAGSEADHEGTHSTKRGHAKSRPV
2990.4 Dihydropyrimidinase-like 2 IPI00106642.4 ILDLGITGPEGHVLSRPEEVEAEAVNR
3315.96 Alpha-fetoprotein IPI00022443 FLGDRDFNQFSSGEKNIFLASFVHEYSR
7763.24 Platelet factor 4 IPI00022446 EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES