Fig. 8From: The plasma peptides of Alzheimer’s diseaseThe primary structure and hydrophobicity plot of Disrupted in Schizophrenia 1 protein isoform a [Homo sapiens] DISC1 NP_001158009.1. The long arrow shows the cleavage site of the tryptic peptides sequences: 1, 1MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFR45; and 2, 83ARQCGLDSR91 from the conserved and unique C-terminal domain of DISC1 that is conserved within humans and across mammals in sequences available to date. The short arrows show the location of the tryptic cleavage sites observedBack to article page