Table 3 Polypeptide identifications
From: Confounding Effects of Benign Lung Diseases on Non-Small Cell Lung Cancer Serum Biomarker Discovery
m/z ratio | p value (Wilcoxon) | Fold change | Polypeptide identification | ||
|---|---|---|---|---|---|
Experiment 1 | Experiment 2 | Experiment 1 | Experiment 2 | ||
1,778 | 4.9 × 10−5 | 2.5 × 10−6 | 3.5 | 11 | Fragment of complement C3f (SKITHRIHWESASLL) |
1,865 | 6.5 × 10−4 | 2.4 × 10−7 | 2.1 | 46 | Fragment of complement C3f (SSKITHRIHWESASLL) |
3,273 | 4.2 × 10 −3 | 1.6 × 10−4 | 1.8 | 7.7 | Fragment of ITIH 4 (MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF) |
3,289 | 9.8 × 10−6 | 1.4 × 10−4 | 2.4 | 8.9 | Fragment of ITIH 4 (M*NFRPGVLSSRQLGLPGPPDVPDHAAYHPF) |
5,080 | 1.6 × 10−8 | 4.1 × 10−3 | 1.7 | 2.2 | Transthyretin fragment |
6,431 | 5.1 × 10−3 | 2.0 × 10−2 | 0.67 | 0.63 | N-terminal truncated apolipoprotein C1 |
6,631 | 2.5 × 10−4 | 3.5 × 10−3 | 0.55 | 0.60 | Apolipoprotein C1 |
13,880 | 6.8 × 10−3 | 7.3 × 10−3 | 0.85 | 0.685 | Transthyretin |
14,070 | 1.3 × 10−3 | 3.5 × 10−4 | 0.71 | 0.64 | Transthyretin |
14,690 | 3.0 × 10−6 | 1.8 × 10−4 | 0.62 | 0.64 | Lysozyme C |