Skip to main content

Table 3 Comparison of the quantification results between TMT and PRM of the 14 candidate different expression proteins

From: Effects of cryopreservation and long-term culture on biological characteristics and proteomic profiles of human umbilical cord-derived mesenchymal stem cells

Protein accession Proteins Signature peptides P4N24/P4C24 P4N24/P10N24 P4C24/P10C24 P10N24/P10C24
Q8IVL6 P3H3 DLETPPHWAAYDTGLELLGR 1.03 1.17 0.96 1.06 0.91 0.86 0.98 0.96
P53814 SMTN AQEIEAATLAGRLQDGTPQAALSPLTPAR 1.04 1.04 1.23 1.27 1.92 3.29 1.63 2.68
Q96CG8 CTHRC1 QCSWSSLNYGIDLGKVLFSGSLR 1.47 2.08 0.89 0.81 0.61 0.39 1.01 1.00
O75326 SEMA7A DPYCGWDQGR 1.06 1.09 1.10 1.08 1.70 3.03 1.64 3.08
P35354 PTGS2 SHLIDSPPTYNADYGYKSGLDDINPTVLLK 1.40 2.79 0.57 0.50 0.81 0.53 2.00 2.99
Q9NQW6 ANLN LLLIATGKGFLTIFEDVSGFGAWHR 1.06 1.08 1.36 1.32 1.71 2.44 1.34 1.99
P58335 ANTXR2 VSPVGETYIHEGLKLDALWALLR 0.87 0.97 0.75 0.70 1.18 1.17 1.36 1.63
P48307 TFPI2 LQVSVDDQCEGSTEKTCDAFTYTGCGGNDNNFVSR 1.08 0.96 0.66 0.47 1.20 1.23 1.98 2.51
Q13642 FHL1 FWHDTCFR 1.56 1.45 2.06 2.00 1.69 2.53 1.28 1.84
Q02241 KIF23 ALLQEFDNAVLSK 0.96 1.05 1.29 1.49 1.59 1.82 1.18 1.28
Q9H0H5 RACGAP1 SIGSAVDQGNESIVAK 0.97 0.87 1.25 1.56 1.50 2.47 1.17 1.38
P53350 PLK1 LILYNDGDSLQYIER 0.96 1.01 1.27 1.89 1.68 2.70 1.27 1.44
P00749 PLAU FEVENLILHK 0.62 0.42 0.43 0.27 1.23 1.50 1.76 2.30
O00762 UBE2C GISAFPESDNLFKLSLEFPSGYPYNAPTVK 1.02 1.05 1.27 1.52 1.63 2.06 1.31 1.42