Effects of cryopreservation and long-term culture on biological characteristics and proteomic profiles of human umbilical cord-derived mesenchymal stem cells

Table 3 Comparison of the quantification results between TMT and PRM of the 14 candidate different expression proteins

Protein accession	Proteins	Signature peptides	P4N24/P4C24		P4N24/P10N24		P4C24/P10C24		P10N24/P10C24
Protein accession	Proteins	Signature peptides	TMT	PRM	TMT	PRM	TMT	PRM	TMT	PRM
Q8IVL6	P3H3	DLETPPHWAAYDTGLELLGR	1.03	1.17	0.96	1.06	0.91	0.86	0.98	0.96
P53814	SMTN	AQEIEAATLAGRLQDGTPQAALSPLTPAR	1.04	1.04	1.23	1.27	1.92	3.29	1.63	2.68
Q96CG8	CTHRC1	QCSWSSLNYGIDLGKVLFSGSLR	1.47	2.08	0.89	0.81	0.61	0.39	1.01	1.00
O75326	SEMA7A	DPYCGWDQGR	1.06	1.09	1.10	1.08	1.70	3.03	1.64	3.08
P35354	PTGS2	SHLIDSPPTYNADYGYKSGLDDINPTVLLK	1.40	2.79	0.57	0.50	0.81	0.53	2.00	2.99
Q9NQW6	ANLN	LLLIATGKGFLTIFEDVSGFGAWHR	1.06	1.08	1.36	1.32	1.71	2.44	1.34	1.99
P58335	ANTXR2	VSPVGETYIHEGLKLDALWALLR	0.87	0.97	0.75	0.70	1.18	1.17	1.36	1.63
P48307	TFPI2	LQVSVDDQCEGSTEKTCDAFTYTGCGGNDNNFVSR	1.08	0.96	0.66	0.47	1.20	1.23	1.98	2.51
Q13642	FHL1	FWHDTCFR	1.56	1.45	2.06	2.00	1.69	2.53	1.28	1.84
Q02241	KIF23	ALLQEFDNAVLSK	0.96	1.05	1.29	1.49	1.59	1.82	1.18	1.28
Q9H0H5	RACGAP1	SIGSAVDQGNESIVAK	0.97	0.87	1.25	1.56	1.50	2.47	1.17	1.38
P53350	PLK1	LILYNDGDSLQYIER	0.96	1.01	1.27	1.89	1.68	2.70	1.27	1.44
P00749	PLAU	FEVENLILHK	0.62	0.42	0.43	0.27	1.23	1.50	1.76	2.30
O00762	UBE2C	GISAFPESDNLFKLSLEFPSGYPYNAPTVK	1.02	1.05	1.27	1.52	1.63	2.06	1.31	1.42

ISSN: 1559-0275