Fig. 7From: The plasma peptides of Alzheimer’s diseaseThe intensity distributions of the peptides from the conserved N terminus of DISC1 across disease and controls treatments. Panels: a The quantile plot of all DISC1 peptide intensity from within the sequence MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFR (inset, the quantile plot of the selected DISC1 peptides ARQCGLDS; b the quantile box plot of the DISC1 peptide ARQCGLDS; c the quantile box plot of the DISC1 peptides within the sequence MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFR; d the quantile box plot of the DISC1 peptides from ARQCGLDS and within the sequence MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFR. Treatment ID numbers: 1, Alzheimer normal; 2, Alzheimer’s normal control STYP; 3, Alzheimer’s dementia; 4, Alzheimer’s dementia STYP; 5, Cancer breast; 6, Cancer breast STYP; 7, Cancer control; 8, Cancer control STYP; 9, Cancer ovarian; 10, Cancer ovarian STYP; 11, Ice Cold; 12, Ice Cold STYP; 13, Heart attack Arterial; 14 Heart attack Arterial STYP; 15, Heart attack normal control, 16, Heart attack normal Control STYP; 17, Heart attack; 18, Heart attack STYP; 19, Multiple Sclerosis normal control; 20, Multiple Sclerosis normal control STYP; 21, Multiple sclerosis; 22, Multiple sclerosis STYP, 23 Sepsis; 24, Sepsis STYP; 25, Sepsis normal control; 26, Sepsis normal control STYP. There was significant effects of treatments and peptides by two-way ANOVABack to article page